PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 284aa    MW: 29376.7 Da    PI: 7.1759
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23156genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof95.92.8e-30130176248
    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrn 48 
               keka++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrn
  EMT23156 130 KEKAINCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRN 176
               7899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-26123177IPR003851Zinc finger, Dof-type
PfamPF027013.6E-26132176IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.179134188IPR003851Zinc finger, Dof-type
PROSITE patternPS013610136172IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEQLDPAAVM IIRIICVRMF KGLAAQMKTT EKDVADEEGL VTGLLYYCYA FEMKEVESKP  60
GLGLVKPMEE MIMAGNPNPN PNPNGNPNPQ PAPPSGAEAQ RAPVPGPPAG GAGAAAGTGS  120
TERKAARPQK EKAINCPRCN STNTKFCYYN NYSLQQPRYF CKTCRRYWTE GGSLRNARQQ  180
QVQNMLGFSL DTGGGGDAGG YGAGLQGAQE SATGRMLFPF EDLKPGTNAG GGGASGGDQV  240
EHSKAQGGGG GGGHETLGFW NNSMIGNGSS NDAGGGGGGG GGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2763571e-147AJ276357.1 Hordeum vulgare mRNA for dof zinc finger protein (sed gene).
GenBankAJ3122971e-147AJ312297.1 Hordeum vulgare sed gene for dof zinc finger protein, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8CIP20.0M8CIP2_AEGTA; Dof zinc finger protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.16e-30Dof family protein